PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.0H351
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 336aa    MW: 36851.2 Da    PI: 9.2234
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.0H351genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32e-14139183347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
      Araip.0H351 139 PWTEEEHKLFLLGLHKVGKGDWRGISRNFVKTRTPTQVASHAQKY 183
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.6314055IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.013132188IPR017930Myb domain
SuperFamilySSF466891.2E-16134187IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-16135186IPR006447Myb domain, plants
SMARTSM007171.3E-10136186IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-10138183IPR009057Homeodomain-like
CDDcd001671.31E-9139184No hitNo description
PfamPF002499.2E-12139183IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
DSNPLIICTN SFSSELYYLS SVSLFSFLYG LREIHMSRTC SQCGNNGHNS RTCTDASLAA  60
GSVSGGGTPQ RENGIMLFGV RLTTTEGTSS SFRKSASMGN LSQFDQQPPQ DPIVADAGYV  120
SDDVVHASGR SRERKRGVPW TEEEHKLFLL GLHKVGKGDW RGISRNFVKT RTPTQVASHA  180
QKYFLRRHNQ NRRRRRSSLF DITTDTVMES SGMMEEQVEQ ETVAPPTPST YNNLSSSTFP  240
MALSCVMLPL AAKPIRPTPI LPVPPSSKMA NLNLKEKITL NTEFRPPPFV LNLGTQQFRN  300
QSPDENNDRS SPSSSSTSSF QAGNFTGGGD SIISVA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00630PBMTransfer from PK17526.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2086700.0KF208670.1 Arachis hypogaea putative MYB-related protein 16 (MYB16) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016202602.10.0PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B07e-47MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLV5T6880.0V5T688_ARAHY; Putative MYB-related protein 16
STRINGGLYMA02G03020.11e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.26e-77MYB_related family protein